Protein coding transcript 194237

• Transcript: Ll_transcript_22451
• CDS coordinates: 2101-2715 (+)
• Peptide sequence: MTDTRKRLLDMGYKNPVLLLHPLGGYTKADDVPLDWRMKQHEKVLEDGVLDPETTVVSIFPSPMHYAGPTEVQWHAKARINAGANFYIVGRDPAGMSHPVEKRDLYDADHGKKVLSMAPGLERLNILPFRVAAYDNVQGKMAFFDPSRPQDFLFISGTKMRTLARNKESPPDGFMCPGGWKVLVDYYDSLAVSTNGKVPEAVPA*
• ORF Type: complete

Annotations of Ll_transcript_22451

• Blastp: ATP sulfurylase 1, chloroplastic from Arabidopsis with 91.13% of identity
• Blastx: ATP sulfurylase 1, chloroplastic from Arabidopsis with 89.3% of identity
• Eggnog: Catalyzes the first intracellular reaction of sulfate assimilation, forming adenosine-5'-phosphosulfate (APS) from inorganic sulfate and ATP. Plays an important role in sulfate activation as a component of the biosynthesis pathway of sulfur- containing amino acids (By similarity)(COG2046)
• Kegg: Link to kegg annotations (AT3G22890)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427328.1)
• Pfam: ATP-sulfurylase (PF01747.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;