Protein coding transcript 194257

• Transcript: Ll_transcript_21254
• CDS coordinates: 1-1044 (+)
• Peptide sequence: VNSSFSSSDFNPRVLLHYGVPSNASILAFDRIQRLLAVGTLDGRIKVFGGDNIEGILFSPKQTSFKNLEFLENRGFLASISSDNEVQVWDLESRQIASALKWESAITAFSVIYGTSYMYIGSEHGMVYVLKFDSEDRKIEILPYYVPTDVISEAVGMSLDNVSVVKVLHQPCSNGNRLLIAYENGVIVLWDASEDRIVLIRGYKDTELKRIHVASFPNDPKNELSDDQLDHEEEDKEICSVSWASSDGSVVVVGYVDGDIMFWDLSTADSPSGQAQKVSKIVIKLQLSSADKRLPVIVLHWCPTKSLDSSGGQLFAYGGDEIGSEEVLTETIMLRKRAESLDASYRL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_21254

• Blastp: Syntaxin-binding protein 5-like from Homo with 24.05% of identity
• Blastx: Syntaxin-binding protein 5-like from Mus with 30.09% of identity
• Eggnog: syntaxin binding protein(ENOG410XTER)
• Kegg: Link to kegg annotations (9515)
• CantataDB: Link to cantataDB annotations (CNT0001782)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433667.1)
• Pfam: WD domain, G-beta repeat (PF00400.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;