| Transcript | Ll_transcript_20496 |
|---|---|
| CDS coordinates | 531-914 (+) |
| Peptide sequence | MQVVLAANDLPSINDVTYSELIEIISKLKDEEGRLVGVSTSNLLIANSGNDLPVIDLTRVSQELAYLASDADLVVLEGMGRGIETNLYAQFKCDSLKIGMVKHPEVAQFLGGRLYDCVFKYNEVSSS* |
| ORF Type | complete |
| Blastp | Uncharacterized protein At2g17340 from Arabidopsis with 84% of identity |
|---|---|
| Blastx | Uncharacterized protein At2g17340 from Arabidopsis with 84.55% of identity |
| Eggnog | Protein of unknown function DUF89(ENOG410XQNK) |
| Kegg | Link to kegg annotations (AT2G17340) |
| CantataDB | Link to cantataDB annotations (CNT0002034) |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019453238.1) |
| Pfam | Protein of unknown function DUF89 (PF01937.18) |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer