Transcript | Ll_transcript_352554 |
---|---|
CDS coordinates | 2-499 (+) |
Peptide sequence | YKGVFCSPALDDEKVTVVSGIDLNHEDIAGYLPVELGLLTDLALFHINSNRFCGIIPKSFSKLQLLFELDVSNNRFVGVFPEVVLELKTLKYLDLRFNNFEGCLPPEVFNRPFDALLLNDNRFRCAIPETIGNSTVSLMVLANNKFTGCIPKTIGNMAGKLNQIIF |
ORF Type | internal |
Blastp | Pollen-specific leucine-rich repeat extensin-like protein 1 from Arabidopsis with 68.67% of identity |
---|---|
Blastx | Pollen-specific leucine-rich repeat extensin-like protein 1 from Arabidopsis with 68.67% of identity |
Eggnog | leucine-rich repeat extensin-like protein(ENOG410Y973) |
Kegg | Link to kegg annotations (AT3G19020) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019459399.1) |
Pfam | Leucine rich repeat (PF13855.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer