| Transcript | Ll_transcript_22650 |
|---|---|
| CDS coordinates | 1-372 (+) |
| Peptide sequence | YRSKIETELSNICDGILKLLDSRLIPSASSGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLAAYKSAQDIANTELPPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDT |
| ORF Type | internal |
| Blastp | 14-3-3-like protein from Pisum with 95.97% of identity |
|---|---|
| Blastx | 14-3-3-like protein from Pisum with 95.97% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019417481.1) |
| Pfam | 14-3-3 protein (PF00244.19) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer