Protein coding transcript 194343

• Transcript: Ll_transcript_22653
• CDS coordinates: 461-760 (+)
• Peptide sequence: MKFLTLLIVLAALQNRLNLWRYSISCSCPVLFFFTITTSCHVLMLFSNYYNPEEFSFRIRQAFDEAIAELDTLGEESYKDSTLIMQLHHDNLALWTSDMQ
• ORF Type: 3prime_partial

Annotations of Ll_transcript_22653

• Blastp: 14-3-3 protein 5 from Lycopersicon with 90.24% of identity
• Blastx: 14-3-3-like protein from Spinacia with 80.39% of identity
• Eggnog: Tyrosine 3-monooxygenase tryptophan 5-monooxygenase activation protein(COG5040)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020237585.1)
• Pfam: 14-3-3 protein (PF00244.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;