Transcript | Ll_transcript_22673 |
---|---|
CDS coordinates | 1766-2392 (+) |
Peptide sequence | MINSVPLEDARHLAQRYSRMRQEAETQREEIARRQARVRESPAAEQVAKLHAAEAKMQELKANMAILGKEAAAALAAVDAQQQRLTFQRLVAMVEGEKTFHLRVAAILGEIEAEMVSDRQKKESAPPVVASENGSGKTMYFLAEALHSYSAESEKELSFSKGDFIVVRKVNASGWSEGECNGKAGWFPSAYVEKRQRIPTSDMAGEVY* |
ORF Type | complete |
Blastp | SH3 domain-containing protein 3 from Arabidopsis with 73.08% of identity |
---|---|
Blastx | SH3 domain-containing protein 3 from Arabidopsis with 73.15% of identity |
Eggnog | SH3 domain(ENOG410ZK1G) |
Kegg | Link to kegg annotations (AT4G18060) |
CantataDB | Link to cantataDB annotations (CNT0001773) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019461383.1) |
Pfam | SH3 domain (PF00018.27) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer