Protein coding transcript 194352

• Transcript: Ll_transcript_22673
• CDS coordinates: 1766-2392 (+)
• Peptide sequence: MINSVPLEDARHLAQRYSRMRQEAETQREEIARRQARVRESPAAEQVAKLHAAEAKMQELKANMAILGKEAAAALAAVDAQQQRLTFQRLVAMVEGEKTFHLRVAAILGEIEAEMVSDRQKKESAPPVVASENGSGKTMYFLAEALHSYSAESEKELSFSKGDFIVVRKVNASGWSEGECNGKAGWFPSAYVEKRQRIPTSDMAGEVY*
• ORF Type: complete

Annotations of Ll_transcript_22673

• Blastp: SH3 domain-containing protein 3 from Arabidopsis with 73.08% of identity
• Blastx: SH3 domain-containing protein 3 from Arabidopsis with 73.15% of identity
• Eggnog: SH3 domain(ENOG410ZK1G)
• Kegg: Link to kegg annotations (AT4G18060)
• CantataDB: Link to cantataDB annotations (CNT0001773)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461383.1)
• Pfam: SH3 domain (PF00018.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;