Protein coding transcript 194361

• Transcript: Ll_transcript_22691
• CDS coordinates: 3-341 (+)
• Peptide sequence: DGKNDDKWWLPTPKVPVDGLSDVARKFLQYQKDCVTQVLKAAMAINAQTLSEMEIPESYIESLPKNGRASLGDTIYRSITDDYFDPDQLLGTMDLSSEHKILDLKNKIEASIV
• ORF Type: internal

Annotations of Ll_transcript_22691

• Blastp: Rop guanine nucleotide exchange factor 12 from Arabidopsis with 77.19% of identity
• Blastx: Rop guanine nucleotide exchange factor 12 from Arabidopsis with 77.19% of identity
• Eggnog: guanine nucleotide exchange factor(ENOG410YG86)
• Kegg: Link to kegg annotations (AT1G79860)
• CantataDB: Link to cantataDB annotations (CNT0002139)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455305.1)
• Pfam: PRONE (Plant-specific Rop nucleotide exchanger) (PF03759.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;