Transcript | Ll_transcript_20451 |
---|---|
CDS coordinates | 78-713 (+) |
Peptide sequence | MANFILRSNKAVHGLGWLCVMLLVHQGAAGYEFIVGGQKGWSVPSDTNFNPFNQRAEKTRFQIGDSIVFNYQSGQDSVLYVKSEDYASCNTASPYAKFSDGHTVIKLIHSGPHFFISGNKNNCLKNEKVTVIVLADRNNHNLSNNNNQTNTASPPSPQSSAPTPAGIVESNPTPAPVSVSYHPHNAATSKVINSAASIGTFMASLLLLLSL* |
ORF Type | complete |
Blastp | Early nodulin-like protein 1 from Arabidopsis with 38.51% of identity |
---|---|
Blastx | Early nodulin-like protein 1 from Arabidopsis with 44.07% of identity |
Eggnog | Early nodulin-like protein(ENOG410YW92) |
Kegg | Link to kegg annotations (AT2G25060) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019413488.1) |
Pfam | Plastocyanin-like domain (PF02298.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer