Transcript | Ll_transcript_20349 |
---|---|
CDS coordinates | 702-1052 (+) |
Peptide sequence | MAQSLSQLGILYCHVIEPRMVTQFQKFDTKWSLMPIRKVFNGTFIVAGGYNRSEGNQVIASGDADLVAYGRLFLANPDLPTRFEVDAELNEPDPNTFYTHDPVIGYTDYPFLQNNS* |
ORF Type | complete |
Blastp | Putative 12-oxophytodienoate reductase 11 from Oryza sativa with 62.61% of identity |
---|---|
Blastx | Putative 12-oxophytodienoate reductase 11 from Oryza sativa with 68.02% of identity |
Eggnog | NADH flavin oxidoreductase, NADH oxidase(COG1902) |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019449518.1) |
Pfam | NADH:flavin oxidoreductase / NADH oxidase family (PF00724.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer