Protein coding transcript 194378

• Transcript: Ll_transcript_20350
• CDS coordinates: 536-1351 (+)
• Peptide sequence: MNIFFQITLKSSFCSGFQPHGQAPISCTDKRIQKDISNSAAATNRYTPPRRLRTDEIPELVNDFRIAAKNAIETGFDGVEIHGANGYLLDQFLKDKVNDRDDEYGGSIENRCRFPLEVVKAIVDEIGADKVGFRLSPFADYNDCGDSDPQALGIYMAQSLSQLGILYCHVIEPRMVTQFQKFDTKWSLMPIRKVFNGTFIVAGGYNRSEGNQVIASGDADLVAYGRLFLANPDLPTRFEVDAELNEPDPNTFYTHDPVIGYTDYPFLQNNS*
• ORF Type: complete

Annotations of Ll_transcript_20350

• Blastp: Putative 12-oxophytodienoate reductase 11 from Oryza sativa with 65.34% of identity
• Blastx: Putative 12-oxophytodienoate reductase 11 from Oryza sativa with 65.34% of identity
• Eggnog: NADH flavin oxidoreductase, NADH oxidase(COG1902)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449516.1)
• Pfam: NADH:flavin oxidoreductase / NADH oxidase family (PF00724.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;