Protein coding transcript 194383

• Transcript: Ll_transcript_20371
• CDS coordinates: 3194-3832 (+)
• Peptide sequence: MGQLGHSSLQYGDKELLPRRVVSLDGIVIKDVACGGVHTCALSKEGALYACGGGQSGQLGLGPQTGLFSCVANDSQTFFRNIPILIVPKDVQFVACGHSHTLISTKEGRIHGWGYNNYGQAANEKCTYAWYPSPVDWCVGEIRKLAAGGGHSAVLTDACSLKELCEFVLADCMTLSNAAKVEDIASRTGSDALARLCGRLRYFVELIRLCMN*
• ORF Type: complete

Annotations of Ll_transcript_20371

• Blastp: Probable E3 ubiquitin-protein ligase HERC4 from Mus with 38.61% of identity
• Blastx: Probable E3 ubiquitin-protein ligase HERC4 from Mus with 38.32% of identity
• Eggnog: ubiquitin protein ligase(COG5021)
• Kegg: Link to kegg annotations (67345)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456541.1)
• Pfam: Regulator of chromosome condensation (RCC1) repeat (PF00415.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;