Transcript | Ll_transcript_20356 |
---|---|
CDS coordinates | 752-1366 (+) |
Peptide sequence | MDIDKILGTTKPASFPRKSAIYVWGYNQSGQTGRKGKQDQLRIPKQLPPELFGCPAGFNARWLDVACGREHTAAIASDGSLFTWGANDYGQLGDGTEERRKHPKKVKQLGSEFVKSVSCGAHCSACIAEPRDNDGTVSTGRLWVWGQNQGSNFPRLFWGAFEPNTVIHQVSCGAAHVVALSEAGLLQAWGESLIASLYFLSNVL* |
ORF Type | complete |
Blastp | RCC1 and BTB domain-containing protein 2 from Rattus with 30.17% of identity |
---|---|
Blastx | RCC1 and BTB domain-containing protein 2 from Rattus with 30.17% of identity |
Eggnog | regulator of chromosome condensation(COG5184) |
Kegg | Link to kegg annotations (290363) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019456545.1) |
Pfam | Regulator of chromosome condensation (RCC1) repeat (PF00415.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer