Protein coding transcript 194399

• Transcript: Ll_transcript_20366
• CDS coordinates: 129-959 (+)
• Peptide sequence: MDIDKILGTTKPASFPRKSAIYVWGYNQSGQTGRKGKQDQLRIPKQLPPELFGCPAGFNARWLDVACGREHTAAIASDGSLFTWGANDYGQLGDGTEERRKHPKKVKQLGSEFVKSVSCGAHCSACIAEPRDNDGTVSTGRLWVWGQNQGSNFPRLFWGAFEPNTVIHQVSCGAAHVVALSEAGLLQAWGYNECGQLGRGVTCEGLQGARILSSYAKFLDEAPELVKITKVSCGEYHTAAISDKGEVYTWGLGNMGQLGHSSLQYGDKELLPRRVVS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_20366

• Blastp: Probable E3 ubiquitin-protein ligase HERC3 from Homo with 33.21% of identity
• Blastx: Probable E3 ubiquitin-protein ligase HERC3 from Homo with 33.21% of identity
• Eggnog: ubiquitin protein ligase(COG5021)
• Kegg: Link to kegg annotations (8916)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456545.1)
• Pfam: Regulator of chromosome condensation (RCC1) repeat (PF00415.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;