Transcript | Ll_transcript_352579 |
---|---|
CDS coordinates | 3-686 (+) |
Peptide sequence | QLTRQMIEMEKRCKVCVTGGSSYLGSFLIKKLLEKGYTVHTTLRNLNDEAKIGILRSFPEANARLVLFKADIYKPHAFEPAIKGCEFVFHIATPYEHQMDSQFKSTSEAAVAAVKSIANYCIESGTVKRLIYTASLLAYSPCKDDGTGFKDYIDETCWTSLNLLNRTIDDDLKNYINSKTQAEKELLSYENGENGSEMEVVSLSCGIVGGENGSEMEVVSLSCGIVGG |
ORF Type | internal |
Blastp | Vestitone reductase from Medicago with 37.44% of identity |
---|---|
Blastx | Vestitone reductase from Medicago with 37.44% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (AAB41550) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019431187.1) |
Pfam | NAD dependent epimerase/dehydratase family (PF01370.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer