Protein coding transcript 194502

• Transcript: Ll_transcript_137576
• CDS coordinates: 119-697 (+)
• Peptide sequence: MEGKGTATATGCYKCGKPGHWSRDCPFSPNPNPNNPNPISNNPNPISNNPSSSSLPSSEKPKKLPRTRPKLTPDLLLSDDGFGYVLRHFPSHFKYRGRGHEVSDLGNLLHLYSDWHSRLLPYYSFPQFVSKLQKVAATRRIKTCLRELRERVADGGDPTKMREPPLFDDILPDQQGTSRISFIHSFSLSRIS*
• ORF Type: complete

Annotations of Ll_transcript_137576

• Blastp: TIMELESS-interacting protein from Gallus with 33.33% of identity
• Blastx: TIMELESS-interacting protein from Xenopus with 35.38% of identity
• Eggnog: Forms a fork protection complex (FPC) with tof1 and which is required for chromosome segregation during meiosis and DNA damage repair. FPC coordinates leading and lagging strand synthesis and moves with the replication fork. FPC stabilizes replication forks in a configuration that is recognized by replication checkpoint sensors (By similarity)(ENOG4111VXN)
• Kegg: Link to kegg annotations (415548)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451182.1)
• Pfam: Zinc knuckle (PF13917.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;