Protein coding transcript 194597

• Transcript: Ll_transcript_139665
• CDS coordinates: 310-840 (+)
• Peptide sequence: MAASSSEASILGIREVDQNQMNQQQSSTPSSSTTPSAPPKKRRNQHGTPYPDSEVIALSPKTLMATNRFICEVCNKGFQREQNLQLHRRGHNLPWKLKQKSTKEQKRKVYLCPEPTCVQHDPSRALGDLTGIKKHYSRKHGEKKWKCEKCSKKYAVQSDWKAHSKTCGTREYRCDCG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_139665

• Blastp: Protein indeterminate-domain 4, chloroplastic from Arabidopsis with 92.14% of identity
• Blastx: Protein indeterminate-domain 4, chloroplastic from Arabidopsis with 92.03% of identity
• Eggnog: Zinc finger protein(COG5048)
• Kegg: Link to kegg annotations (AT2G02080)
• CantataDB: Link to cantataDB annotations (CNT0000237)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017426406.1)
• Pfam: C2H2-type zinc finger (PF13912.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;