| Transcript | Ll_transcript_138712 |
|---|---|
| CDS coordinates | 37-300 (+) |
| Peptide sequence | MSAFQYMLLGMEHIQIALIFGIMCFVASLVGLSVVKRAIKKYGRASLIVFSVSIVMSLSTVLMTTFGAIKVLRDYKSGRSMGFKLPC* |
| ORF Type | complete |
| Blastp | Sulfite exporter TauE/SafE family protein 2 from Arabidopsis with 68.97% of identity |
|---|---|
| Blastx | Sulfite exporter TauE/SafE family protein 2 from Arabidopsis with 71.72% of identity |
| Eggnog | Sulfite exporter TauE/SafE(ENOG4111QQH) |
| Kegg | Link to kegg annotations (AT1G61740) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019418648.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer