Transcript | Ll_transcript_138712 |
---|---|
CDS coordinates | 37-300 (+) |
Peptide sequence | MSAFQYMLLGMEHIQIALIFGIMCFVASLVGLSVVKRAIKKYGRASLIVFSVSIVMSLSTVLMTTFGAIKVLRDYKSGRSMGFKLPC* |
ORF Type | complete |
Blastp | Sulfite exporter TauE/SafE family protein 2 from Arabidopsis with 68.97% of identity |
---|---|
Blastx | Sulfite exporter TauE/SafE family protein 2 from Arabidopsis with 71.72% of identity |
Eggnog | Sulfite exporter TauE/SafE(ENOG4111QQH) |
Kegg | Link to kegg annotations (AT1G61740) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019418648.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer