Protein coding transcript 194686

• Transcript: Ll_transcript_137771
• CDS coordinates: 2-1198 (+)
• Peptide sequence: CFRYMCLVFHILTPDSVIFLIEFNLFSFYVLILAPDSVIFVYVIQPRFSFVLIQRIALSWMVQKETSNVYCSGGILADDQGLGKTVSTIALILKERPPVLNTCNDAQKSELQTLNLDADDDLLPENGGVKKEFDTCQGMSRYPIKTMNLLVPRKGRPSGGTLIVCPTSVLRQWAEELHNKVTCKAKLSVLVYHGSNRTKDPYELAKYDIVLTTYSIVSLEVPKQPLVDKDDEEKGIYEDHTVPSRKRKYPPNSSKSGKKVLDSMMLEAIARPLAKAAWFRVVLDEAQSIKNHRTQVARACWGLRAKRRWCLSGTPIQNAIDDLYSYFRFLRYEPYAVYTSFCSTIKIPISRSPSKGYRKLQAVLKTIMLRRTKGTLLDGEPIISLPPKSVELKKVDFSQ
• ORF Type: internal

Annotations of Ll_transcript_137771

• Blastp: Helicase-like transcription factor CHR28 from Arabidopsis with 59.18% of identity
• Blastx: Helicase-like transcription factor CHR28 from Arabidopsis with 59.18% of identity
• Eggnog: Transcription termination factor, RNA polymerase II(ENOG410XPDU)
• Kegg: Link to kegg annotations (AT1G50410)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440268.1)
• Pfam: SNF2 family N-terminal domain (PF00176.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;