Transcript | Ll_transcript_139065 |
---|---|
CDS coordinates | 169-597 (+) |
Peptide sequence | MSSLNPYAASYVPLSKKEPSRVTFGTEKGSYNHDGRNLFYSSSSASHNMPGDFQPASNSFGSSSQNAALLPDDLFTDEDHIDMDIEFLKMSFPDISVQSLRDIYILNEEDLDAAIDMLDQLEVVIYVFSLQIYSSIDHKLWN* |
ORF Type | complete |
Blastp | Polyadenylate-binding protein-interacting protein 6 from Arabidopsis with 35.77% of identity |
---|---|
Blastx | Polyadenylate-binding protein-interacting protein 6 from Arabidopsis with 35.77% of identity |
Eggnog | NA(ENOG41114K2) |
Kegg | Link to kegg annotations (AT5G25540) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019437660.1) |
Pfam | - |
Rfam | - |
GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer