Protein coding transcript 194823

• Transcript: Ll_transcript_139420
• CDS coordinates: 3-452 (+)
• Peptide sequence: EMSSLTKAMCWDLVTINKDKLNHVGAAIYRKPTSNECYERREKSQPPMCKDNDDPNAAWYVPLQACMHKVPVNKAERGAKWPEEWPRRLHKAPYWLNNSQLGVYKKPAATDFSEDDERWKNVVDELSNIGITWSNVRNVMDMKAVYGGFA
• ORF Type: internal

Annotations of Ll_transcript_139420

• Blastp: Probable methyltransferase PMT27 from Arabidopsis with 69.74% of identity
• Blastx: Probable methyltransferase PMT27 from Arabidopsis with 69.74% of identity
• Eggnog: Methyltransferase(ENOG410Y2C5)
• Kegg: Link to kegg annotations (AT3G51070)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421795.1)
• Pfam: Putative S-adenosyl-L-methionine-dependent methyltransferase (PF03141.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;