Protein coding transcript 194847

• Transcript: Ll_transcript_139439
• CDS coordinates: 184-1428 (+)
• Peptide sequence: MENISQPDQSPTVFGLGSTYPKTGMLNDDQCFLLYFITGTYFGPDVKGETPKKSVLQRVAEGLPPYTSDQLTSSFMKVVELERAYYYILRKADKSLSIKLLLLRQFFQGQGEYGDGNYPKFSDLFPPELHPQSRFRYKVVENIVFINNPETFYMKQEDVERFKKLSGLEDFQVDKDAARLHTAVDGNVLFNMSVKQAEPNGNMPTIQSCSSTSRARSGDDFSEPQDPLQHVHVVEPTSSVPYSGTGMMYSCMSPLPPEDETDSEKVCPAMLFLPSRPTKKEWSDIVAATKNGFALTGSAATGQVGPNVGLMDIGECEDSYLFRVSLPGVKRDEKYFSCEVDTEGKVLIHGVTTTGEKTISRFSQVFEMQTHNLCPPGDFSITFQLPGPVDPHQFSGNFGTDGILEGMIMKRKHT*
• ORF Type: complete

Annotations of Ll_transcript_139439

• Blastp: Alpha-crystallin domain-containing protein 22.3 from Arabidopsis with 49.51% of identity
• Blastx: Alpha-crystallin domain-containing protein 22.3 from Arabidopsis with 49.51% of identity
• Eggnog: NA(ENOG41118EA)
• Kegg: Link to kegg annotations (AT1G54850)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441159.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;