Transcript | Ll_transcript_139843 |
---|---|
CDS coordinates | 1-681 (+) |
Peptide sequence | AVLWLLLTGKIPSKEQVDSLAAELRSRATIPDYAYKAIDALPVSAHAMTQFTTGVMALQVQSEFQKAYEGGIAKARYWEPTYEDSLNLIARLPSIAAYIYRRKYKDGKIIPMDDSLDYGANYAHMLGFDDPEMLEFMRLYISIHSDHEGGNVSSHTAHLVASPLSDPYLAFAAALNGLAGPLHGLANQEVLRWIRSIVAEFGTPDISKEQLSDYIHKTLNSGQVVPG |
ORF Type | internal |
Blastp | Citrate synthase, mitochondrial from Citrus with 76.82% of identity |
---|---|
Blastx | Citrate synthase, mitochondrial from Citrus with 76.82% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019443636.1) |
Pfam | Citrate synthase, C-terminal domain (PF00285.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer