Protein coding transcript 194939

• Transcript: Ll_transcript_139851
• CDS coordinates: 1033-1650 (+)
• Peptide sequence: MRSLFFIADYAYKAIDALPVSAHAMTQFTTGVMALQVQSEFQKAYEGGIAKARYWEPTYEDSLNLIARLPSIAAYIYRRKYKDGKIIPMDDSLDYGANYAHMLGFDDPEMLEFMRLYISIHSDHEGGNVSSHTAHLVASPLSDPYLAFAAALNGLAGPLHGLANQEVLRWIRSIVAEFGTPDISKEQLSDYIHKTLNSGQVTLHD*
• ORF Type: complete

Annotations of Ll_transcript_139851

• Blastp: Citrate synthase, mitochondrial from Citrus with 73.76% of identity
• Blastx: Citrate synthase, mitochondrial from Citrus with 73.76% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443636.1)
• Pfam: Citrate synthase, C-terminal domain (PF00285.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;