Protein coding transcript 194976

• Transcript: Ll_transcript_139933
• CDS coordinates: 135-548 (+)
• Peptide sequence: MANAASGMAVHDDCKLRFQELKSKRSYRFILFKIEQQQVVVDKLGEPTQSYDDFMATFPADECRYAVYDFDFITQENCQKSKIYFIAWSPDSSRVRMKMVYASSKDRFKRELDGIQVELQATDPSEMSLDIVKGRAL*
• ORF Type: complete

Annotations of Ll_transcript_139933

• Blastp: Actin-depolymerizing factor 7 from Arabidopsis with 82.48% of identity
• Blastx: Actin-depolymerizing factor 7 from Arabidopsis with 82.48% of identity
• Eggnog: actin-depolymerizing factor(ENOG41122P5)
• Kegg: Link to kegg annotations (AT4G25590)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423261.1)
• Pfam: Cofilin/tropomyosin-type actin-binding protein (PF00241.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;