Protein coding transcript 1950

• Transcript: Ll_transcript_352552
• CDS coordinates: 1-360 (+)
• Peptide sequence: LKQMGVQKGDTVALYMPMIPEAVVAFLACSRIGAVHSVVFAGFSSDSLRDRIIDAKTKVVITTDEGKRGGKTIGTKKIVDDALKQCPDITHCLVYKRTGTEVPFTKGRDLWWHEETEKWP
• ORF Type: internal

Annotations of Ll_transcript_352552

• Blastp: Acetyl-coenzyme A synthetase from Aspergillus with 80% of identity
• Blastx: Acetyl-coenzyme A synthetase from Aspergillus with 80% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AN5626.2)
• CantataDB: -
• Mirbase: hvu-MIR6189 (MI0021504)
• Ncbi protein: Link to NCBI protein (XP_004493118.1)
• Pfam: AMP-binding enzyme (PF00501.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;