| Transcript | Ll_transcript_138638 |
|---|---|
| CDS coordinates | 624-929 (+) |
| Peptide sequence | MHVIAIGIFGLKKLPLASALTVPLPILTLLFNEYCQKRFFPLFKNYPAECLIKKDRADDEHNMPEFYDKLANAYIDPALTPINYSERTDSRTLPLLHGSEA* |
| ORF Type | complete |
| Blastp | CSC1-like protein At1g69450 from Arabidopsis with 56.73% of identity |
|---|---|
| Blastx | CSC1-like protein HYP1 from Arabidopsis with 60.16% of identity |
| Eggnog | transmembrane protein 63C(COG5594) |
| Kegg | Link to kegg annotations (AT1G69450) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019428753.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer