Protein coding transcript 195063

• Transcript: Ll_transcript_138640
• CDS coordinates: 2215-3111 (+)
• Peptide sequence: MFLSFIPPVMVMLSSLQGSISWSLIQKSACTKVLLFSIWNIFFANVLSGSALYRVNVFLEPKDIPRVLAEAVPSQASFFIAYVVTTGWTTIASELFQLPKLIFNFINRIFRRKIGDGFEPPSIPYHSEIPRIRLFALLGVTYFILAPLMLPFLLVYFCLGYIIYRNQLLKVYVPKYETGGGYWPTVHNSTIYSLVLMHVIAIGIFGLKKLPLASALTVPLPVLTLLFNEYCQKRFLPLFKDYPAECLIKKDRTDQNEQNMPEFYDKLANAYNDPALLPTKYSESSDSHTSPLLHGSAT*
• ORF Type: complete

Annotations of Ll_transcript_138640

• Blastp: CSC1-like protein HYP1 from Arabidopsis with 64.58% of identity
• Blastx: CSC1-like protein HYP1 from Arabidopsis with 62.61% of identity
• Eggnog: transmembrane protein 63C(COG5594)
• Kegg: Link to kegg annotations (AT3G01100)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452941.1)
• Pfam: Calcium-dependent channel, 7TM region, putative phosphate (PF02714.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;