Transcript | Ll_transcript_138642 |
---|---|
CDS coordinates | 2-730 (+) |
Peptide sequence | KYYSMNCRIRSSLFGILYLVQASFFIAYVVTTGWTTIASELFQLTKLAFNFMKRIFRRNGDDFDPPSIPYHSEIPRIRLFALFGVTYFILAPLILPFLLVYFCLGYIIYRNQLLKVYVPKYETGGGYWPTVHNSTILSLVLMHVIAIGIFGLKKLPLASALTVPLPILTLLFNEYCQKRFFPLFKNYPAECLIKKDRADDEHNMPEFYDKLANAYIDPALTPINYSERTDSRTLPLLHGSEA* |
ORF Type | 5prime_partial |
Blastp | CSC1-like protein HYP1 from Arabidopsis with 60.19% of identity |
---|---|
Blastx | CSC1-like protein HYP1 from Arabidopsis with 60.19% of identity |
Eggnog | transmembrane protein 63C(COG5594) |
Kegg | Link to kegg annotations (AT3G01100) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019428753.1) |
Pfam | Calcium-dependent channel, 7TM region, putative phosphate (PF02714.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer