Protein coding transcript 195116

• Transcript: Ll_transcript_139142
• CDS coordinates: 307-654 (+)
• Peptide sequence: MMQAFYTLFRDDDQMKLPHFIAIAGVACGMFAICIPHLSALGIWLGVSTVFSTTYSVIAIVLSIKDGIRSPARDYSMPGDNDTNKVFSTIGSAASLVFAFNTGMVPEIQVKKEAH*
• ORF Type: complete

Annotations of Ll_transcript_139142

• Blastp: Proline transporter 2 from Arabidopsis with 66.67% of identity
• Blastx: Proline transporter 2 from Arabidopsis with 66.67% of identity
• Eggnog: amino acid transport(COG0814)
• Kegg: Link to kegg annotations (AT3G55740)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419741.1)
• Pfam: Transmembrane amino acid transporter protein (PF01490.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;