Protein coding transcript 19512

• Transcript: Ll_transcript_417479
• CDS coordinates: 203-766 (+)
• Peptide sequence: MHGSFITFFLYPKMKSLTSFFIPRNTLFIIHLTKSISSIASLPHTVTTVHPHPPNDIPSHLFTILSQPNWQNNLNLKTLVPYINPSHVSTLFGFGISPNTALDFFNWVARKEHGYRHSAHCYASLLEILVCNSLPRVAENVRISMIKSSDSVEDVRFVLDFLRGMSLNCDDVKCQGCFNITTVFSHSQ
• ORF Type: 3prime_partial

Annotations of Ll_transcript_417479

• Blastp: Pentatricopeptide repeat-containing protein At5g65560 from Arabidopsis with 39.6% of identity
• Blastx: Pentatricopeptide repeat-containing protein At5g65560 from Arabidopsis with 45.45% of identity
• Eggnog: Pentatricopeptide repeat-containing protein(ENOG410Z7Z7)
• Kegg: Link to kegg annotations (AT5G65560)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460676.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;