Protein coding transcript 195166

• Transcript: Ll_transcript_139729
• CDS coordinates: 519-899 (+)
• Peptide sequence: MLLFTNEDDPFGSMNGAIKSDMTRTTLQRAKDAQDLGISIELLPLSCPDEVFNVSQFYADLIGLEGDHLVDFMPSAGNKYVILSTIFSGLFLVFVWSVTYQYHYVLKWGATSCIIWSLAYATYLVL*
• ORF Type: complete

Annotations of Ll_transcript_139729

• Blastp: ATP-dependent DNA helicase 2 subunit KU70 from Oryza sativa with 72.15% of identity
• Blastx: ATP-dependent DNA helicase 2 subunit KU70 from Arabidopsis with 75.63% of identity
• Eggnog: X-ray repair complementing defective repair in Chinese hamster cells 6(ENOG410XNXU)
• Kegg: Link to kegg annotations (4342584)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441579.1)
• Pfam: Ku70/Ku80 N-terminal alpha/beta domain (PF03731.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;