Protein coding transcript 1953

• Transcript: Ll_transcript_352564
• CDS coordinates: 2-388 (+)
• Peptide sequence: RERKQRRNSKQQNMSVSAIFGCRVMIAPTSFGINNVKSIPTINNNNNNYCGGLTIECSSRPQKKGTAHHKKTRPRKTQPWDIKKKPTVYAPLPPLPPEWSFVISADDSSDVTSSTVVLQPESDVALAP*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_352564

• Blastp: 50S ribosomal protein 6, chloroplastic from Arabidopsis with 55.88% of identity
• Blastx: 50S ribosomal protein 6, chloroplastic from Arabidopsis with 59.78% of identity
• Eggnog: 50S ribosomal protein 6(ENOG410Y35U)
• Kegg: Link to kegg annotations (AT5G17870)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415512.1)
• Pfam: Family of unknown function (DUF5323) (PF17257.1)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;