| Transcript | Ll_transcript_137928 |
|---|---|
| CDS coordinates | 2-376 (+) |
| Peptide sequence | RYSLTSRNLVFLIIHSHQTLILCFTNLMELYACLPKFPSSLLLKSSVRVFHKTLNPSFQPFQASNFSTNFTQIRNPKNISCAALVGDINTSTPSTLPLSDPGARIGEVNRVTQEPNVSVKRVTKE |
| ORF Type | internal |
| Blastp | Imidazoleglycerol-phosphate dehydratase from Pisum with 49.02% of identity |
|---|---|
| Blastx | Imidazoleglycerol-phosphate dehydratase from Pisum with 44.12% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019437437.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer