Protein coding transcript 195347

• Transcript: Ll_transcript_137946
• CDS coordinates: 1706-2542 (+)
• Peptide sequence: MELSAPPRLAKCFPSQFLNFRVRIFQRTLNPTPQPLRASIFSVNHLNLTRMHNPRNVSSAALVGDIDTSAPTTLPLVNSVARIGEVKRVTKETNVAVKINLDGSGVADSSTGIPFLDHMLDQIASHGVFDVHVKAKGDIHIDDHHTNEDVALAIGTALLQALGDRKGINRFGDFSAPLDEALVHVSLDLSGRPHLGYNLDIPTQRVGTYDTQLVEHFFQSLVNTSGMTLHIRQLAGANSHHIIEATFKAFARALRQATEYDPRRRGTVPSSKGVLSRS*
• ORF Type: complete

Annotations of Ll_transcript_137946

• Blastp: Imidazoleglycerol-phosphate dehydratase from Pisum with 77.74% of identity
• Blastx: Imidazoleglycerol-phosphate dehydratase from Pisum with 77.74% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461334.1)
• Pfam: Imidazoleglycerol-phosphate dehydratase (PF00475.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;