Transcript | Ll_transcript_137931 |
---|---|
CDS coordinates | 2-442 (+) |
Peptide sequence | RYSLTSRNLVFLIIHSHQTLILCFTNLMELYACLPKFPSSLLLKSSVRVFHKTLNPSFQPFQASNFSTNFTQIRNPKNISCAALVGDINTSTPSTLPLSDPGARIGEVKRVTKETNVSVKINLDGSGVADSSTGIPFLDHMLDVSF* |
ORF Type | 5prime_partial |
Blastp | Imidazoleglycerol-phosphate dehydratase from Pisum with 60.8% of identity |
---|---|
Blastx | Imidazoleglycerol-phosphate dehydratase 1, chloroplastic from Arabidopsis with 87% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019437436.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer