Transcript | Ll_transcript_137997 |
---|---|
CDS coordinates | 204-629 (+) |
Peptide sequence | MSDHLVLYVDRLVRPIPVEPMSQDPVQPSPEPSVLVDAAAVAGPSDSSLMESDGEGEGEDEEERLLQMAECRICQEEDSVSNLESPCTCRGSLKYAHRKCVQHWCNEKGDITCEICHKPYQPGYTAPPPCPRPEETTIDIG* |
ORF Type | complete |
Blastp | ERAD-associated E3 ubiquitin-protein ligase DOA10 from Saccharomyces with 43.55% of identity |
---|---|
Blastx | ERAD-associated E3 ubiquitin-protein ligase DOA10 from Saccharomyces with 43.55% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (YIL030C) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_017422663.1) |
Pfam | RING-variant domain (PF12906.6) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer