Transcript | Ll_transcript_137885 |
---|---|
CDS coordinates | 3-572 (+) |
Peptide sequence | SMSKLTNNYINISSLCCFFASPIQTKEMSFATHCSSYSYSTSLLQSHPIRPTFLSLHANYDSKRFNTAPRNHRVIISAAFDDRSSNLDSEIKRRKVVEHVCLVKAKEDLSEEEENDMLDYLYTTQYQMGGVVATSLGRVSGPNPEHYTHALYMRFQGKENLEKFYENPFYLKVLKDHVMTYCHVCTNKD* |
ORF Type | 5prime_partial |
Blastp | Stress-response A/B barrel domain-containing protein UP3 from Arabidopsis with 27% of identity |
---|---|
Blastx | Stress-response A/B barrel domain-containing protein UP3 from Arabidopsis with 26.32% of identity |
Eggnog | stress responsive A B Barrel domain containing protein, expressed(ENOG4111VSH) |
Kegg | Link to kegg annotations (AT2G31670) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019446601.1) |
Pfam | Stress responsive A/B Barrel Domain (PF07876.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer