Protein coding transcript 195518

• Transcript: Ll_transcript_137868
• CDS coordinates: 3-572 (+)
• Peptide sequence: SMSKLTNNYINISSLCCFFASPIQTKEMSFATHCSSYSYSTSLLQSHPIRPTFLSLHANYDSKRFNTAPRNHRVIISAAFDDRSSNLDSEIKRRKVVEHVCLVKAKEDLSEEEENDMLDYLYTTQYQMGGVVATSLGRVSGPNPEHYTHALYMRFQGKENLEKFYENPFYLKVLKDHVMTYCHVCTNKD*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_137868

• Blastp: Stress-response A/B barrel domain-containing protein UP3 from Arabidopsis with 27% of identity
• Blastx: Stress-response A/B barrel domain-containing protein UP3 from Arabidopsis with 26.32% of identity
• Eggnog: stress responsive A B Barrel domain containing protein, expressed(ENOG4111VSH)
• Kegg: Link to kegg annotations (AT2G31670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446601.1)
• Pfam: Stress responsive A/B Barrel Domain (PF07876.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;