Protein coding transcript 1956

• Transcript: Ll_transcript_352523
• CDS coordinates: 2-670 (+)
• Peptide sequence: ATLRSPPKPHKPHILYVDGDSIPFIVAKSTSSFTQLVSHTSKNVKDLHPLVPKLPKSRSLEDGTSLLSLLSIQVTLLSNSGFSMCVNFNHVVADGKAFHHFMKSWSSLCRTKGDLTSLKGLLPFHDRAMIVDPKKLELCFLNEFWNWPSEQREKTKNDPLEDKVRGTFILSHEQVQKVRKWVSSKCSSNELETLHLSTFVVTCSLIWVCLAIRTEHCQRQRMS
• ORF Type: internal

Annotations of Ll_transcript_352523

• Blastp: Coumaroyl-CoA:anthocyanidin 3-O-glucoside-6''-O-coumaroyltransferase 1 from Arabidopsis with 37.62% of identity
• Blastx: Coumaroyl-CoA:anthocyanidin 3-O-glucoside-6''-O-coumaroyltransferase 1 from Arabidopsis with 37.62% of identity
• Eggnog: Anthocyanin 5-aromatic(ENOG410ZBAM)
• Kegg: Link to kegg annotations (AT1G03940)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454569.1)
• Pfam: Transferase family (PF02458.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;