Transcript | Ll_transcript_139758 |
---|---|
CDS coordinates | 1621-2400 (+) |
Peptide sequence | MSKFVVSIYDHFYFLHFLFLQPQLETEKSNKGRGSAVELKDQSISSKQEKPKTSRAERRALQEAQRAAKAEGNKASGTAKPVKPAKPAQKVDNAVVAAPEKKGGDPPEKDRKKDAPQPRMQYDDKNRVEKARRRAVVKQPEARNRVELFRHLPQYEHGSRLQDLEAKFFHLDSVHPAVYKVGLQYLLGDISGSNARCTAMLQAFQEAIKDYKVPPEKTLVRDLTAKISSYVSFLIECRPLSISMGNAIRFLKSRIAKLPL |
ORF Type | 3prime_partial |
Blastp | Translation initiation factor eIF-2B subunit delta from Homo with 40.67% of identity |
---|---|
Blastx | Translation initiation factor eIF-2B subunit delta from Mus with 47.86% of identity |
Eggnog | translation initiation factor(COG1184) |
Kegg | Link to kegg annotations (8890) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019452993.1) |
Pfam | Initiation factor 2 subunit family (PF01008.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer