Protein coding transcript 195612

• Transcript: Ll_transcript_139755
• CDS coordinates: 1621-2364 (+)
• Peptide sequence: MSKFVVSIYDHFYFLHFLFLQPQLETEKSNKGRGSAVELKDQSISSKQEKPKTSRAERRALQEAQRAAKAEGNKAYGDATSANAKPAKPAKPAQKVDNSASVASEKKAGDPPEKDRKKDVPQPRMQYDDKNRVEKARRRAVVKQTEARNRVELFRHLPQYEHGSQLPDLEAKFFHLDSVHPAVYKVGLQYLLGDISCGNDRCIAMLEAFQEAIKDYRVPPEKTLVRDLTAKISSYVSFLIECRPLSIS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_139755

• Blastp: Translation initiation factor eIF-2B subunit delta from Homo with 38.5% of identity
• Blastx: Translation initiation factor eIF-2B subunit delta from Mus with 47.06% of identity
• Eggnog: translation initiation factor(COG1184)
• Kegg: Link to kegg annotations (8890)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452993.1)
• Pfam: Initiation factor 2 subunit family (PF01008.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;