Transcript | Ll_transcript_139533 |
---|---|
CDS coordinates | 176-709 (+) |
Peptide sequence | MEKKRIDDHEPGPVPSPRALDRFGFVKQEVSASDSLVKNRSAYENERIREERKVRKWRKMIGVGGSDWKHYLRRKPHVVERRIRKGIPDCLRGLVWQLISGSRDLLLMNPGVYEQLVIYETSSSELDIIRDISRTFPSHVFFRQRHGPGQRSLYNVLKAYSVFDRNVGYVQVLLMRIT |
ORF Type | 3prime_partial |
Blastp | TBC1 domain family member 10A from Homo with 35.71% of identity |
---|---|
Blastx | TBC1 domain family member 10B from Mus with 36.31% of identity |
Eggnog | TBC1 domain family member(ENOG410XPSR) |
Kegg | Link to kegg annotations (83874) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019453278.1) |
Pfam | Rab-GTPase-TBC domain (PF00566.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer