Protein coding transcript 195655

• Transcript: Ll_transcript_139537
• CDS coordinates: 176-1249 (+)
• Peptide sequence: MEKKRIDDHEPGPVPSPRALDRFGFVKQEVSASDSLVKNRSAYENERIREERKVRKWRKMIGVGGSDWKHYLRRKPHVVERRIRKGIPDCLRGLVWQLISGSRDLLLMNPGVYEQLVIYETSSSELDIIRDISRTFPSHVFFRQRHGPGQRSLYNVLKAYSVFDRNVGYVQGMGFLAGLLLLYMSEEDAFWLLVALLKGAVHAPMEGLYLAGLPLVQQYLSQFEQLVKEHLPKLGEHFSQEMINPSMYASQWFITVFSYSFPFHLALRIWDVFLYEGVKIVFKVGLALLMYCHDDLIKLPFEKLLHALKKFPEDAMNPDTILPLAYSIKISKRLEELTQEYEKNGKVAQSGELSEKH*
• ORF Type: complete

Annotations of Ll_transcript_139537

• Blastp: Ecotropic viral integration site 5 ortholog from Sophophora with 39.79% of identity
• Blastx: Ecotropic viral integration site 5 ortholog from Sophophora with 39.79% of identity
• Eggnog: ecotropic viral integration site(ENOG410YWJY)
• Kegg: Link to kegg annotations (Dmel_CG11727)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453278.1)
• Pfam: Rab-GTPase-TBC domain (PF00566.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;