Protein coding transcript 195656

• Transcript: Ll_transcript_139539
• CDS coordinates: 353-703 (+)
• Peptide sequence: MEKKRIDDYEPGPPPPPRPLDRFGFFKQDVTASDSLAKNRSAYEYERIREERSVRKWRKMIGVGGSDWKHYVRRKPHVVKRRIRKGIPDCLRGLVWQLISGSRDLLLMNPGVYEVI*
• ORF Type: complete

Annotations of Ll_transcript_139539

• Blastp: TBC1 domain family member 10B from Mus with 44.07% of identity
• Blastx: Ecotropic viral integration site 5 protein homolog from Homo with 43.13% of identity
• Eggnog: TBC1 domain family member(ENOG410XPSR)
• Kegg: Link to kegg annotations (68449)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419899.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;