Transcript | Ll_transcript_139518 |
---|---|
CDS coordinates | 353-1027 (+) |
Peptide sequence | MEKKRIDDYEPGPPPPPRPLDRFGFFKQDVTASDSLAKNRSAYEYERIREERSVRKWRKMIGVGGSDWKHYVRRKPHVVKRRIRKGIPDCLRGLVWQLISGSRDLLLMNPGVYEQLVIYETSTSELDIIRDISRTFPSHVFFRQRHGPGQRSLYNVLKAYSVFDRNVGYVQGMGFLAGLLLLYMSEEDAFWLLVALLKGAVHAPMEGLYLVLFLSMNLIELITN* |
ORF Type | complete |
Blastp | Ecotropic viral integration site 5 ortholog from Sophophora with 45.93% of identity |
---|---|
Blastx | Ecotropic viral integration site 5 ortholog from Sophophora with 45.93% of identity |
Eggnog | ecotropic viral integration site(ENOG410YWJY) |
Kegg | Link to kegg annotations (Dmel_CG11727) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019419899.1) |
Pfam | Rab-GTPase-TBC domain (PF00566.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer