Protein coding transcript 195687

• Transcript: Ll_transcript_138142
• CDS coordinates: 1747-2085 (+)
• Peptide sequence: MGILLVYDVTDESSFNNIRNWIRNIEQHASDNVNKILVGNKADMDESKRAVPTSKGQALADEYGIKFFETSAKTNLNVEEVFFSIARDIKQRLADTDTKAEPAGIKINQQDQA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_138142

• Blastp: Ras-related protein RABE1c from Arabidopsis with 92.92% of identity
• Blastx: Ras-related protein RABE1c from Arabidopsis with 92.5% of identity
• Eggnog: member RAS oncogene family(ENOG410XPUI)
• Kegg: Link to kegg annotations (AT3G46060)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458010.1)
• Pfam: Ras family (PF00071.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;