Protein coding transcript 195689

• Transcript: Ll_transcript_138147
• CDS coordinates: 1-543 (+)
• Peptide sequence: APPARARAADYDYLIKLLLIGDSGVGKSCILLRFSDGSFTTSFITTIGIDFKIRTIEMDGKRIKLQIWDTAGQERFRTITTAYYRGAMGILLVYDVTDEASFNNIRNWIRNIEQHASDNVNKILVGNKADMDESKRAVPTSKGQALADEYGIKFFETSAKTNLNVEEVFFSIARDIKQRLA
• ORF Type: internal

Annotations of Ll_transcript_138147

• Blastp: Ras-related protein RAB1BV from Beta with 97.67% of identity
• Blastx: Ras-related protein RAB1BV from Beta with 97.62% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (104900163)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413050.1)
• Pfam: ADP-ribosylation factor family (PF00025.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;