Protein coding transcript 195690

• Transcript: Ll_transcript_138151
• CDS coordinates: 2-334 (+)
• Peptide sequence: AGQERFRTITTAYYRGAMGILLVYDVTDEASFNNIRNWIRNIEQHASDNVNKILVGNKADMDESKRAVPTSKGQALADEYGIKFFETSAKTNLNVEEVFFSIARDIKQRLA
• ORF Type: internal

Annotations of Ll_transcript_138151

• Blastp: Ras-related protein RAB1BV from Beta with 98.2% of identity
• Blastx: Ras-related protein RAB1BV from Beta with 98.2% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (104900163)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (NP_001242369.1)
• Pfam: Ras family (PF00071.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;