Transcript | Ll_transcript_511071 |
---|---|
CDS coordinates | 2-526 (+) |
Peptide sequence | LLVLRFPQTKPKNQIHCKKRANFRSKKNCKAKMMHMTFYWSKNVTILIDSWRTDSWLSYVLSLVACIVASVFYQYLENRRIRLKLLAGKASPAAAEIQVPLLRRKLVAGGKVRVGGAVLFGLSSAIGYLLMLAVMSFNGGVFVAIVVGLAFGHFIFRSEGEEGSVVVDSSCACA* |
ORF Type | 5prime_partial |
Blastp | Copper transporter 5 from Arabidopsis with 51.7% of identity |
---|---|
Blastx | Copper transporter 5 from Arabidopsis with 52.38% of identity |
Eggnog | Solute carrier family 31 copper transporters member(ENOG4111I8D) |
Kegg | Link to kegg annotations (AT5G20650) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019437825.1) |
Pfam | Ctr copper transporter family (PF04145.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer