Protein coding transcript 1957

• Transcript: Ll_transcript_511071
• CDS coordinates: 2-526 (+)
• Peptide sequence: LLVLRFPQTKPKNQIHCKKRANFRSKKNCKAKMMHMTFYWSKNVTILIDSWRTDSWLSYVLSLVACIVASVFYQYLENRRIRLKLLAGKASPAAAEIQVPLLRRKLVAGGKVRVGGAVLFGLSSAIGYLLMLAVMSFNGGVFVAIVVGLAFGHFIFRSEGEEGSVVVDSSCACA*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_511071

• Blastp: Copper transporter 5 from Arabidopsis with 51.7% of identity
• Blastx: Copper transporter 5 from Arabidopsis with 52.38% of identity
• Eggnog: Solute carrier family 31 copper transporters member(ENOG4111I8D)
• Kegg: Link to kegg annotations (AT5G20650)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437825.1)
• Pfam: Ctr copper transporter family (PF04145.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;